A practical reference on AEDG: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
This page was last updated on 2026-03-24 and is reviewed periodically as new material appears.
The published literature is dominated by a small number of research groups, much of it in Russian-language journals, and independent replication outside those groups is limited. Studies are typically small, use cultured cells or rodent models, and report endpoints that differ between papers, which makes comparison difficult. Large randomised human trials have not appeared in the indexed literature. Questions about absorption, distribution and clearance are therefore still treated as open in reviews that mention the compound.
Epitalon is a synthetic tetrapeptide with the sequence alanine–glutamate–aspartate–glycine, commonly abbreviated AEDG. Its design traces to epithalamin, a peptide fraction prepared from bovine pineal gland extracts that researchers in Saint Petersburg began investigating in the 1970s. The compound has a molecular formula of C14H22N4O9 and a nominal molecular mass near 390 daltons. It holds no approved drug status in the United States or the European Union, and material sold under this name is generally offered as a research chemical rather than a finished pharmaceutical product.
The proposed relationship between epitalon and pineal function is a central part of its background. Khavinson's group reported that short peptides corresponding to regions of larger pineal proteins could influence gene expression in cells. Epitalon was framed as a synthetic analogue of an active fragment rather than a direct isolation product. Whether the tetrapeptide reproduces the effects of the parent extract is an open question, because comparative studies are limited and the parent extract itself is not a single defined substance.
Interest in epitalon is usually discussed within the broader field of short peptide bioregulators, a category that includes other synthetic di-, tri-, and tetrapeptides studied by the same research group. These compounds share a common rationale: that small fragments of tissue-derived proteins can retain biological activity and can be produced reproducibly. The category as a whole remains outside mainstream pharmacological consensus, and epitalon specifically has a limited presence in independent, non-Russian research literature, which shapes how its evidence base is described.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C14H22N4O9 | Synthetic tetrapeptide, four residues |
| Nominal mass | Approximately 390 Da | Free peptide; salt forms differ |
| Appearance | White to off-white powder | Commonly supplied lyophilised |
| Solubility class | Freely soluble in water | Also dissolves in aqueous buffer |
| Typical storage | −20 °C, desiccated | Cold packs used during transport |
Material supplied for laboratory use is normally a lyophilised white to off-white powder that dissolves readily in water and in isotonic saline. Lyophilised cakes are hygroscopic and should be equilibrated to room temperature before opening to limit condensation on the solid. Solutions are typically prepared at milligram-per-millilitre concentrations and divided into single-use aliquots, because repeated freeze–thaw cycles degrade short peptides. Aqueous solutions are far less stable than the dry powder, and identity is usually verified by mass spectrometry alongside purity estimation from reversed-phase high-performance liquid chromatography.
Epitalon is a synthetic linear tetrapeptide with the sequence alanine–glutamate–aspartate–glycine, abbreviated AEDG. Its molecular formula is C14H22N4O9 and the calculated mass is approximately 390.35 g/mol. The compound is made by solid-phase peptide synthesis rather than extracted from tissue, although early work described it as a short fragment of a peptide fraction obtained from bovine pineal extract. In the research literature the spelling epitalon and the variant epithalone both appear, while AEDG is the standard code used in peptide nomenclature.
Published evidence comes mainly from Russian-language journals and from a single research group, with small sample sizes and limited independent replication. A few laboratories outside that group have examined related peptides and reported weaker or absent telomerase effects, so the central claim is best described as contested rather than settled. Rodent studies report modest changes in some ageing markers and in survival, but designs vary and control conditions are often sparse. No large randomised trial in humans has been published, and long-term safety data in healthy populations are correspondingly thin.
Epitalon is a synthetic tetrapeptide with the sequence alanine-glutamate-aspartate-glycine, commonly abbreviated AEDG. It was designed at the St. Petersburg Institute of Bioregulation and Gerontology as a short, chemically defined analogue of epithalamin, a fraction obtained from bovine pineal tissue. Small peptide bioregulators of this type formed a long-running line of work there from the 1980s onward. Because the molecule is produced by solid-phase synthesis rather than extraction, its composition is exact and its purity can be measured directly.
Laboratory-grade epitalon is typically supplied as a lyophilized powder. Purity is commonly assessed with reverse-phase high-performance liquid chromatography, often paired with mass spectrometry to confirm molecular identity. Amino acid analysis and peptide mapping can provide additional confirmation of sequence. Certificates of analysis for research materials frequently report purity above 95 percent, although the methods behind such figures vary between suppliers. The absence of a pharmacopeial monograph means that no single standardized assay defines the compound, so reported results depend on the analytical protocol chosen.
Storage recommendations center on limiting moisture, heat, and light. The dry powder is generally kept at minus 20 degrees Celsius, and some suppliers recommend minus 80 degrees for long-term archival. Once dissolved, solutions are usually aliquoted and frozen to avoid repeated freeze-thaw cycles, which can promote aggregation or degradation. Aqueous stability depends on pH and concentration, and buffered saline is often preferred over plain water for biological work. Stability data specific to epitalon remain limited, so general peptide-handling practices are applied by analogy rather than from product-specific validation.
Epitalon is a synthetic tetrapeptide with the sequence alanine-glutamate-aspartate-glycine, abbreviated AEDG. Its molecular formula is C14H22N4O9 and its calculated monoisotopic mass is approximately 390.35 daltons. The compound does not occur naturally as a free peptide; it is produced by solid-phase peptide synthesis. Because it contains two acidic residues and no basic residues, the neutral form carries a net negative charge at physiological pH. This charge profile influences how the peptide behaves in solution and during chromatographic analysis.
Published work on this compound consists mainly of in vitro experiments, animal studies, and small clinical investigations, a substantial share of which appeared in Russian-language journals. Sample sizes are generally small, control conditions differ between studies, and several endpoints rely on markers whose clinical meaning is itself debated. Reviews of the longevity field treat the peptide as an early example of telomerase-directed research rather than an established intervention. Regulatory treatment varies by country: some jurisdictions place it under prescription controls, others treat it as a laboratory material, and importation may be restricted regardless of local status.
Epitalon is a synthetic tetrapeptide whose sequence is alanine–glutamate–aspartate–glycine, commonly abbreviated AEDG. It was developed in Russia during the 1980s and 1990s by investigators associated with the St. Petersburg Institute of Bioregulation and Gerontology, who studied short peptides as regulators of gene expression and tissue function. The alternative spelling epithalon appears interchangeably in the literature, and the two names refer to the same molecule. Outside Russia it is encountered chiefly as a research chemical rather than a licensed medicine, and it holds no approval from the United States Food and Drug Administration or the European Medicines Agency.
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
Willes (1963), former president of the Federal Reserve Bank of Minneapolis, CEO and Publisher of Los Angeles Times and Deseret Management Corporation Harry Saal (1963), co-founder of Network General Corporation, developer of the Sniffer Steven Clifford (1964), former CEO of King Broadcasting Company and National Mobile Television Arthur Cutler (1965), restaurateur, founder of Carmine's, Ollie's, and owner of Murray's Sturgeon Shop Ed Goodgold (1965), music industry executive and former manager of Sha Na Na, coined the term "trivia" Michael Gould (1966), former CEO of Bloomingdale's Julian Geiger (1967), former CEO of Aéropostale and current CEO of Crumbs Bake Shop Richard Sackler (1967), billionaire chairman and president of Purdue Pharma known for the development of Oxycontin Denny Greene (1971), former executive at Columbia Pictures, professor at University of Dayton School of Law, and member of Sha Na Na Mark E. Kingdon (1971), hedge fund manager, president of Kingdon Capital Management Philip L. Milstein (1971), former chairman and CEO of Emigrant Savings Bank, son of billionaire real estate developer Seymour Milstein Christopher M. Jeffries (1972), real estate developer, former husband of Princess Yasmin Aga Khan Marc Porat (1972), entrepreneur in information technology and sustainable materials; co-founder of General Magic John R. Eckel Jr. (1973), founder, CEO and chairman of Copano Energy Finbarr O'Neill (1973), former CEO of J.D. Power Fred Seibert (1973), TV producer and first creative director of MTV Robert B.
== Overview == Developmental bioelectricity is a sub-discipline of biology, related to, but distinct from, neurophysiology and bioelectromagnetics. Developmental bioelectricity refers to the endogenous ion fluxes, transmembrane and transepithelial voltage gradients, and electric currents and fields produced and sustained in living cells and tissues. This electrical activity is often used during embryogenesis, regeneration, and cancer suppression—it is one layer of the complex field of signals that impinge upon all cells in vivo and regulate their interactions during pattern formation and maintenance. This is distinct from neural bioelectricity (classically termed electrophysiology), which refers to the rapid and transient spiking in well-recognized excitable cells like neurons and myocytes (muscle cells); and from bioelectromagnetics, which refers to the effects of applied electromagnetic radiation, and endogenous electromagnetics such as biophoton emission and magnetite.
The government claims modern retail will create 4 million new jobs. This cannot be true because Walmart, with over 9000 stores worldwide, has only 2.1 million employees. By allowing modern retail there could be more stores in total than Walmart has over the world, it's not unfeasible for 20,000 stores in India which would indeed create more than 4 million jobs. Let's not forget that India has ~3 times the population of the United States. The Democratic staff of the U.S. House Committee on Education and the Workforce Report- Wal-Mart's low wages and their effect on taxpayers and economic growth. Supporters claim none of these objections has merit. They claim:
Sources: en.wikipedia.org
=== Food constituents === Resistant starch from high-amylose corn, amylomaize, has been shown to reduce insulin resistance in healthy individuals, in individuals with insulin resistance, and in individuals with type 2 diabetes. Some types of polyunsaturated fatty acids (omega-3) may moderate the progression of insulin resistance into type 2 diabetes, however, omega-3 fatty acids appear to have limited ability to reverse insulin resistance, and they cease to be efficacious once type 2 diabetes is established.
=== Weight regulation === Melatonin's potential to regulate weight gain is posited to involve its inhibitory effect on leptin, a hormone that serves as a long-term indicator of the body's energy status.
=== Pharmacokinetics === Absorption Dapoxetine is a white, powdery, water-insoluble substance. Taken one to three hours before sexual activity, it is rapidly absorbed in the body. Its maximum plasma concentration (Cmax) is reached one to two hours after oral administration. The Cmax and AUC (area under the plasma vs. time curve) is dose dependent. The Cmax and Tm (time needed to obtain the maximum plasma concentration) after single doses of dapoxetine 30 mg and 60 mg are 297 and 498 ng/ml at 1.01 and 1.27 hours, respectively. A high-fat meal does reduce the Cmax slightly, but it is insignificant. In fact, food does not alter dapoxetine pharmacokinetics. It can be taken with or without food.
=== 1979 === January 1: The United States and China normalize diplomatic relations. January 7: Vietnam deposes the Khmer Rouge and installs a pro-Vietnam, pro-Soviet government known as the People's Republic of Kampuchea. January 16: The Iranian Revolution ousts the pro-Western Shah, Mohammed Reza Pahlavi, and installs a theocracy under Grand Ayatollah Ruhollah Khomeini. The Central Treaty Organization dissolves as a result. February 17: Sino-Vietnamese War, China launches a punitive attack on Vietnam to punish it for invading Cambodia February 22: Saint Lucia becomes independent from the UK. February 24: A war broke out between Yemen Arab Republic and South Yemen. May 4: Margaret Thatcher is elected Prime Minister of the United Kingdom, becoming the first female to lead a major Western democracy. May 9: Civil war breaks out in El Salvador between Marxist-led insurgents and the U.S.-backed government. June 2: Pope John Paul II begins his first pastoral visit to his native Poland. June 18: U.S. President Jimmy Carter and Soviet leader Leonid Brezhnev sign the SALT II agreement, outlining limitations and guidelines for nuclear weapons. July 3: President Carter signs the first directive for financial aid to opponents of the pro-Soviet regime in Kabul, Afghanistan. July 16: Saddam Hussein becomes President of Iraq after Ahmed Hassan al-Bakr steps down. July 17: Marxist-led Sandinista revolutionaries overthrow the U.S.-backed Somoza dictatorship in Nicaragua. The Contra insurgency begins shortly thereafter.
CaO + H2O → Ca(OH)2 Ca(OH)2 + CO2 → CaCO3 + H2O Calcium carbonate can be crystallized from calcium chloride (CaCl2), by placing an aqueous solution of CaCl2 in a desiccator alongside ammonium carbonate [NH4]2CO3. In the desiccator, ammonium carbonate is exposed to air and decomposes into ammonia, carbon dioxide, and water. The carbon dioxide then diffuses into the aqueous solution of calcium chloride, reacts with the calcium ions and the water, and forms calcium carbonate.
Sources: en.wikipedia.org
The cells of fungi have in addition to the shared eukaryotic organelles a spitzenkörper in their endomembrane system, associated with hyphal tip growth. It is a phase-dark body that is composed of an aggregation of membrane-bound vesicles containing cell wall components, serving as a point of assemblage and release of such components intermediate between the Golgi and the cell membrane. The spitzenkörper is motile and generates new hyphal tip growth as it moves forward. The cell walls of fungi are uniquely made of a chitin-glucan complex. Chloroplasts are not found in fungal cells, their pigments are instead associated with their cell walls.
sovramagnificentissimamente (cited by Dante Alighieri in De vulgari eloquentia), 27 letters, "in a way that is more than magnificent by far" (archaic); incontrovertibilissimamente, 27 letters, "in a way that is very difficult to falsify"; particolareggiatissimamente, 27 letters, "in an extremely detailed way"; anticostituzionalissimamente, 28 letters, "in a way that strongly violates the constitution". The longest accepted neologism is psiconeuroendocrinoimmunologia (30 letters).. Other long words are:
Internal Medicine Gastroenterology Gastroenterology Respiratory Medicine Blood / Chemotherapy Clinical Oncology Surgery Gastroenterological Surgery Respiratory Surgery Breast / Endocrine Surgery (breast gland, thyroid) Neurosurgery Gynecology Urology Otolaryngology (head and neck surgery) Orthopedic Surgery Radiotherapy Examination Department Digestive Examination Department Precision Diagnosis Department (Human Dock) Central Surgery Department Laboratory Diagnosis Department Isotope Department Radiology Department Clinical Laboratory Department Pathology / Cytopathology Department
The 2021 Global Burden of Disease Survey found that 1.31 million people worldwide have severe thalassemia while thalassemia trait occurs in 358 million people, causing 11,100 deaths per annum. It is slightly more prevalent in males than females. It is most common among people of Greek, Italian, Middle Eastern, South Asian, and African descent. Those who have minor degrees of thalassemia, in common with those who have sickle-cell trait, have some protection against malaria, explaining why sickle-cell trait and thalassemia are historically more common in regions of the world where the risk of malaria is higher.
Surface Plasmon Resonance (SPR) does not require labeling of the ligand. Instead, it works by measuring the change in the angle at which the polarized light is reflected from a surface (refractive index). The angle is related to the change in mass or layer of thickness, such as immobilization of a ligand changing the resonance angle, which increases the reflected light. The device for which SPR is derived includes a sensor chip, a flow cell, a light source, a prism, and a fixed angle position detector.
Sources: en.wikipedia.org
No. Epithalamin is a heterogeneous peptide fraction obtained from pineal gland extract and contains many components. Epitalon is a single synthetic tetrapeptide with the sequence Ala-Glu-Asp-Gly. Researchers synthesised the shorter peptide while attempting to identify active sequences within the extract.
No endogenous peptide with this exact sequence has been described as a circulating hormone or signalling molecule. The tetrapeptide was designed as a synthetic analogue based on fragments observed in pineal preparations. Any activity discussed in the literature therefore refers to administered material rather than to a natural pool of the compound.
It is not an approved medicine in major jurisdictions and does not appear in the major pharmacopoeias. Material is usually distributed as a research chemical or laboratory reagent. Such labelling places handling responsibility on the purchaser and does not indicate that a regulatory body has reviewed the substance.
Epitalon is a synthetic tetrapeptide composed of four amino acids: alanine, glutamate, aspartate, and glycine. It is written as Ala-Glu-Asp-Gly. The free peptide has a molecular weight of about 390 daltons and is normally supplied as a lyophilized powder.