Backbone hydrolysis is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Updated 2025-12-29. Numbers and descriptions here follow the published literature rather than marketing material.
Material sold for research use varies widely in documented quality. A useful verification package includes a certificate of analysis that states peptide content rather than only net weight, the chromatographic method and column used, and a mass spectrum consistent with the expected mass. Independent testing by a third-party laboratory is occasionally reported. Statements of identity resting only on a supplier label provide little assurance, and the gap between nominal mass and actual peptide content can be substantial once counterions and residual water are counted.
Peptides of this size are generally stable as dry solids but degrade in solution over time. The principal routes are hydrolysis of the peptide backbone and oxidation, with hydrolysis favoured by elevated temperature and extreme pH. Aqueous solutions held at room temperature can show measurable loss of purity within days, while frozen aliquots are considerably more durable. Because the sequence contains neither cysteine nor methionine, oxidation is less of a concern than for many other peptides, but pH control during handling still matters.
Stability depends strongly on pH, temperature and the presence of oxygen and trace metals. Cleavage of the backbone proceeds faster under neutral to alkaline conditions, whereas acidic solutions tend to slow that reaction. The aspartate and glutamate side chains can undergo deamidation or imide formation over time, generating closely related impurities. Published stability data specific to epitalon are sparse, so the usable life of a given solution is best regarded as an open question that depends on buffer composition, concentration and storage temperature.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography with ultraviolet detection, frequently near 214 nanometers where the peptide bond absorbs. Mass spectrometry, most often with electrospray ionization, confirms the observed molecular mass and helps separate the intact peptide from truncated or modified forms. Amino acid analysis or tandem mass spectrometry can establish residue order. Purity is commonly quoted as an area percentage, yet such values are method-dependent, and comparisons between laboratories require matching column, gradient and detection wavelength.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Lyophilized solid |
| Solubility | Freely soluble in water | Also dissolves in polar organic solvents |
| Typical storage temperature | −20 °C or below | Sealed, desiccated, protected from light |
| Primary purity assay | Reversed-phase HPLC | Ultraviolet detection near 214 nm |
| Identity confirmation | Mass spectrometry | Electrospray ionization commonly used |
Freeze-dried epitalon is normally kept at minus twenty degrees Celsius in a sealed, desiccated container, protected from light. Short excursions at ambient temperature during shipping are generally tolerated, but repeated warming and cooling cycles encourage moisture uptake, which shortens shelf life. Once dissolved, the peptide is far less stable than the solid: aqueous solutions are subject to hydrolysis and to deamidation at the aspartate and glutamate residues. Working solutions are therefore held refrigerated and used within days, and repeated freezing and thawing of the same vial is best avoided.
Identity and purity are checked by reversed-phase high-performance liquid chromatography, usually with ultraviolet detection near 214 nanometres, where the peptide bond absorbs. Mass spectrometry confirms the expected mass and reveals whether truncation products or adducts are present. Acid hydrolysis followed by amino acid analysis gives the residue ratio, which should approximate one alanine, one glutamate, one aspartate and one glycine. Counter-ions such as acetate or trifluoroacetate remain in the dried product and lower net peptide content, so a stated purity figure on a label does not by itself describe how much peptide a vial holds.
Regulatory treatment differs by country. No formulation of epitalon holds a marketing authorisation as a medicine in the United States or the European Union, where material sold for laboratory use is handled as a research chemical and is not intended for human consumption. In Russia, several short peptide preparations from the same institute's peptide series are registered medicinal products, and epitalon appears in that national context. Elsewhere it is frequently offered as a cosmetic ingredient, a category with lighter requirements. Advertising claims about longevity or disease prevention are restricted in most jurisdictions, which limits how sellers describe the compound.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
After replication of the desired region, the RNA primer is removed by DNA polymerase I via the process of nick translation. The removal of the RNA primer allows DNA ligase to ligate the DNA-DNA nick between the new fragment and the previous strand. DNA polymerase I & III, along with many other enzymes are all required for the high fidelity, high-processivity of DNA replication. Beta clamp DNA polymerase DNA replication Overview at Oregon State University DNA+Polymerase+III at the U.S. National Library of Medicine Medical Subject Headings (MeSH) Clamping down on pathogenic bacteria[link removed] – how to shut down a key DNA polymerase complex
Aminosalicylic acid was introduced to clinical use in 1944. It was the second antibiotic found to be effective in the treatment of tuberculosis, after streptomycin. PAS formed part of the standard treatment for tuberculosis prior to the introduction of rifampicin and pyrazinamide. Its potency is less than that of the current five first-line drugs (isoniazid, rifampicin, ethambutol, pyrazinamide, and streptomycin) for treating tuberculosis and its cost is higher, but it is still useful in the treatment of multidrug-resistant tuberculosis. PAS is always used in combination with other anti-TB drugs. 4-Aminosalicylic acid has also been used in the treatment of inflammatory bowel disease (ulcerative colitis and Crohn's disease), but has been superseded by other drugs such as sulfasalazine and mesalazine. 4-Aminosalicylic acid has been investigated for the use in manganese chelation therapy, and a 17-year follow-up study shows that it might be superior to other chelation protocols such as EDTA.
Since Urbain was on the commission which made the decision, its objectivity could be questioned; furthermore, Welsbach protested that Urbain's spectral evidence was weak and argued that his rival's lutetium was very impure, but to no avail. After Urbain's names were recognized, neoytterbium was reverted to ytterbium. The controversy died down after 1910, only to be reignited with the discovery of element 72. Urbain claimed in 1911 to have discovered a new rare earth named celtium and identified it as element 72. However, Niels Bohr had demonstrated from his quantum theory that element 72 had to be a group 4 element and not a rare earth, and based on an idea by Fritz Paneth, Bohr's friend George de Hevesy worked with Dirk Coster to search for it in zirconium minerals. This they succeeded in doing, discovering hafnium in 1923. This discovery announcement, being in direct conflict with Urbain's celtium, ignited a controversy on element 72 throughout the 1920s; the resulting investigations on the nature of Urbain's celtium, since it was not the same as hafnium, reopened the case on element 71. The physicists Hans M. Hansen and Sven Werner, at Bohr's Copenhagen institute, found in 1923 that Welsbach's 1907 samples of cassiopeium had been pure element 71, while Urbain's 1907 lutecium samples only contained traces of element 71 and his 1911 samples identified as celtium were actually pure element 71 – confirming Welsbach's criticism.
Sources: en.wikipedia.org
Homosexual acts are prohibited by law in Ghana. According to a 2013 survey by the Pew Research Center, 96% of Ghanaians believe that homosexuality should not be accepted by society. In 2026 further laws were introduced creating a duty to report homosexual acts and to criminalise "supporters" of LGBTQ+ people. Sometimes elderly women in Ghana are accused of witchcraft, particularly in rural Ghana. Issues of witchcraft mainly remain as speculations based on superstitions within families. In some parts of northern Ghana witch camps exist. These are said to house a total of around 1,000 people accused of and ostracised for witchcraft. The Ghanaian government announced that it intended to close the camps. Over a decade later, in 2023, the Anti-Witchcraft bill passed in parliament, to address accusations and the social impacts of being accused of being a witch, and the president refused to sign it into law. The legislation was reintroduced in 2025.
== Prevention == The first control method is preventive and aims to eradicate the adult flies before they can cause any damage. The second control method is treatment once the infestation is present, and concerns the infected animals (including humans). The principal control method of adult populations of myiasis-inducing flies involves insecticide applications in the environment where the target livestock is kept. Organophosphorus or organochlorine compounds may be used, usually in a spraying formulation. One alternative prevention method is the sterile insect technique (SIT) where a significant number of artificially reared sterilized (usually through irradiation) male flies are introduced. The male flies compete with wild breed males for females to copulate and thus cause females to lay batches of unfertilized eggs that cannot develop into the larval stage. One prevention method involves removing the environment most favourable to the flies, such as by removal of the tail. Another example is the crutching of sheep, which involves the removal of wool from around the tail and between the rear legs, which is a favourable environment for the larvae. Another, more permanent, practice that is used in some countries is mulesing, where the skin is removed from young animals to tighten remaining skin – leaving it less prone to fly attack. To prevent myiasis in humans, there is a need for general improvement of sanitation, personal hygiene, and extermination of the flies by insecticides.
Gotcha! (1985 film) is a film about a college student named Jonathan (Anthony Edwards) who plays a game called Gotcha in which he hunts and is hunted by other students with paint guns on campus. Jonathan goes to France on vacation, meets a beautiful woman named Sasha (Linda Fiorentino), travels with her to East Germany, and unknowingly becomes involved in the spy game between the US and USSR. The Kremlin Letter is a 1970 American neo-noir espionage thriller set in the winter of 1969–1970, at the height of US-Soviet tensions. No Way Out a 1987 film about a spy myth that is created to cover up the killing of the mistress of a high American official.
Sources: en.wikipedia.org
The powder is normally kept at −20 °C or below in a sealed, moisture-protected container. Letting the vial reach room temperature before opening helps prevent condensation on the contents.
Reversed-phase HPLC with ultraviolet detection is the usual approach, often paired with mass spectrometry. Together the two methods address both chromatographic purity and molecular identity.
Differences arise from the analytical method, the detection wavelength, and whether the number refers to the peptide or to total powder mass. Counterion and water content can lower the actual peptide fraction considerably.
The dry powder is typically held at -20 degrees Celsius or lower, protected from light and moisture. Allowing a sealed vial to reach room temperature before opening reduces condensation on its contents. Conditions stated on a supplier certificate of analysis take precedence over general guidance.